SSBP1 (NM_003143) Human Mass Spec Standard

SKU
PH315106
SSBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003134)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215106]
Predicted MW 17.26 kDa
Protein Sequence
Protein Sequence
>RC215106 representing NM_003143
Red=Cloning site Green=Tags(s)

MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS
EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL
SDQTKEKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003134
RefSeq Size 628
RefSeq ORF 444
Synonyms Mt-SSB; mtSSB; SOSS-B1; SSBP
Locus ID 6742
UniProt ID Q04837
Cytogenetics 7q34
Summary SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501].[supplied by OMIM, Feb 2010]
Protein Families Druggable Genome
Protein Pathways DNA replication, Homologous recombination, Mismatch repair
Write Your Own Review
You're reviewing:SSBP1 (NM_003143) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401092 SSBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401092 Transient overexpression lysate of single-stranded DNA binding protein 1 (SSBP1) 100 ug
$436.00
TP315106 Recombinant protein of human single-stranded DNA binding protein 1 (SSBP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.