ATG7 (NM_006395) Human Mass Spec Standard

SKU
PH315079
ATG7 MS Standard C13 and N15-labeled recombinant protein (NP_006386)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215079]
Predicted MW 77.8 kDa
Protein Sequence
Protein Sequence
>RC215079 representing NM_006395
Red=Cloning site Green=Tags(s)

MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAF
DMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLK
KYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLV
SLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVA
HSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDL
DKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAAS
KRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPG
DSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFL
SRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDD
ETI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006386
RefSeq Size 2396
RefSeq ORF 2109
Synonyms APG7-LIKE; APG7L; GSA7
Locus ID 10533
UniProt ID O95352
Cytogenetics 3p25.3
Summary This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Protein Pathways Regulation of autophagy
Write Your Own Review
You're reviewing:ATG7 (NM_006395) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401928 ATG7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428569 ATG7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401928 Transient overexpression lysate of ATG7 autophagy related 7 homolog (S. cerevisiae) (ATG7), transcript variant 1 100 ug
$665.00
LY428569 Transient overexpression lysate of ATG7 autophagy related 7 homolog (S. cerevisiae) (ATG7), transcript variant 3 100 ug
$436.00
TP315079 Recombinant protein of human ATG7 autophagy related 7 homolog (S. cerevisiae) (ATG7), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.