Amylin (IAPP) (NM_000415) Human Mass Spec Standard

SKU PH315074

IAPP MS Standard C13 and N15-labeled recombinant protein (NP_000406)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC215074]
• Predicted MW: 9.81 kDa
• Protein Sequence:
  Protein Sequence

  >RC215074 representing NM_000415; Red=Cloning site Green=Tags(s); ; MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY; GKRNAVEVLKREPLNYLPL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000406
• RefSeq Size: 1462
• RefSeq ORF: 267
• Synonyms: DAP; IAP
• Locus ID: 3375
• UniProt ID: P10997
• Cytogenetics: 12p12.1
• Summary: This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Maturity onset diabetes of the young