ACCN4 (ASIC4) (NM_018674) Human Mass Spec Standard

SKU
PH315051
ACCN4 MS Standard C13 and N15-labeled recombinant protein (NP_061144)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215051]
Predicted MW 72 kDa
Protein Sequence
Protein Sequence
>RC215051 representing NM_018674
Red=Cloning site Green=Tags(s)

MLSGAAGAARRGGAALAPSLTRSLAGTHAGADSCAGADKGSHKETIEERDKRQQRQQRQRQHQGCGAAGS
GSDSPTSGPHPVPVLFPLALSLEEQPLPPLPLGRAPGLLAREGQGREALASPSSRGQMPIEIVCKIKFAE
EDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFLY
QAAGLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAA
GLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSG
LEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPW
GNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPDSLGGGPEGPCFCPTPCNLTRYGK
EISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIG
ASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGISTLGLQELKEQSPCPSLGRAEGGGVSSLLPN
HHHPHGPPGGLFEDFAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061144
RefSeq Size 2754
RefSeq ORF 1941
Synonyms ACCN4; BNAC4
Locus ID 55515
UniProt ID Q96FT7
Cytogenetics 2q35
Summary This gene belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. This gene is predominantly expressed in the pituitary gland, and was considered a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder, however, no correlation was found between mutations in this gene and PDC. [provided by RefSeq, Feb 2012]
Protein Families Druggable Genome, Ion Channels: Other
Write Your Own Review
You're reviewing:ACCN4 (ASIC4) (NM_018674) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303827 ACCN4 MS Standard C13 and N15-labeled recombinant protein (NP_878267) 10 ug
$3,255.00
LC405379 ASIC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405379 Transient overexpression lysate of amiloride-sensitive cation channel 4, pituitary (ACCN4), transcript variant 2 100 ug
$436.00
TP303827 Recombinant protein of human amiloride-sensitive cation channel 4, pituitary (ACCN4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315051 Recombinant protein of human amiloride-sensitive cation channel 4, pituitary (ACCN4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.