LRSAM1 (NM_138361) Human Mass Spec Standard

SKU
PH315025
LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_612370)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215025]
Predicted MW 83.6 kDa
Protein Sequence
Protein Sequence
>RC215025 protein sequence
Red=Cloning site Green=Tags(s)

MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVLIVHTNHLTSL
LPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLPRSIGNLTQLQTLNVKDNKLK
ELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSLDASAMVYPPREVCGAGTAAILQFLCKESGL
EYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQRE
HTQLLQQSSSQKDEILQTVKEEQSRLEQGLSEHQRHLDAERQRLQEQLKQTEQNISSRIQKLLQDNQRQK
KSSEILKSLENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQIKLIETELLQLTQLEL
KRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKSETRQENYWLIQYQRLLNQKP
LSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILRRVQELL
DAARIQPELKPPMGEVVTPTAPQEPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCC
QPLRTCPLCRQDIAQRLRIYHSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612370
RefSeq Size 3405
RefSeq ORF 2169
Synonyms CMT2P; RIFLE; TAL
Locus ID 90678
UniProt ID Q6UWE0
Cytogenetics 9q33.3-q34.11
Summary This gene encodes a ring finger protein involved in a variety of functions, including regulation of signaling pathways and cell adhesion, mediation of self-ubiquitylation, and involvement in cargo sorting during receptor endocytosis. Mutations in this gene have been associated with Charcot-Marie-Tooth disease. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:LRSAM1 (NM_138361) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300920 LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005373) 10 ug
$3,255.00
PH323778 LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005374) 10 ug
$3,255.00
LC408632 LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423706 LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423707 LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434379 LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408632 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 1 100 ug
$436.00
LY423706 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 2 100 ug
$436.00
LY423707 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 3 100 ug
$665.00
LY434379 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 4 100 ug
$665.00
TP300920 Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315025 Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323778 Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.