Annexin A2 (ANXA2) (NM_001002858) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC215009] |
Predicted MW | 40.2 kDa |
Protein Sequence |
Protein Sequence
>RC215009 representing NM_001002858
Red=Cloning site Green=Tags(s) MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVD EVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLG TDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELID QDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQC IQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALL YLCGGDD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001002858 |
RefSeq Size | 1635 |
RefSeq ORF | 1071 |
Synonyms | ANX2; ANX2L4; CAL1H; HEL-S-270; LIP2; LPC2; LPC2D; P36; PAP-IV |
Locus ID | 302 |
UniProt ID | P07355 |
Cytogenetics | 15q22.2 |
Summary | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms. [provided by RefSeq, Dec 2019] |
Protein Families | Druggable Genome, Secreted Protein, Stem cell - Pluripotency |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304988 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_004030) | 10 ug |
$3,255.00
|
|
PH305081 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001002857) | 10 ug |
$3,255.00
|
|
PH327328 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001129487) | 10 ug |
$3,255.00
|
|
LC400369 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC400370 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418296 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427764 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429181 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400369 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 2 | 100 ug |
$436.00
|
|
LY400370 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 1 | 100 ug |
$436.00
|
|
LY418296 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 3 | 100 ug |
$436.00
|
|
LY427764 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 4 | 100 ug |
$436.00
|
|
TP304988 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP305081 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP315009 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP327328 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 4, 20 µg | 20 ug |
$867.00
|
|
TP750206 | Purified recombinant protein of Human annexin A2 (ANXA2), full length, tag free, expressed in E.coli, 50ug | 50 ug |
$226.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.