INSM1 (NM_002196) Human Mass Spec Standard

SKU
PH315007
INSM1 MS Standard C13 and N15-labeled recombinant protein (NP_002187)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215007]
Predicted MW 52.7 kDa
Protein Sequence
Protein Sequence
>RC215007 representing NM_002196
Red=Cloning site Green=Tags(s)

MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAAL
ACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGG
GGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEP
PAKAVKAPGAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPF
ALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHKPRPAPAAARAPEPEAAARAEAREAPGGGSDRD
TPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPLAPPAEDLLALYPGPDEKAPQ
EAAGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINK
CHPSENRQVILLQVPVRPAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002187
RefSeq Size 2838
RefSeq ORF 1530
Synonyms IA-1; IA1
Locus ID 3642
UniProt ID Q01101
Cytogenetics 20p11.23
Summary Insulinoma-associated 1 (INSM1) gene is intronless and encodes a protein containing both a zinc finger DNA-binding domain and a putative prohormone domain. This gene is a sensitive marker for neuroendocrine differentiation of human lung tumors. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:INSM1 (NM_002196) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419479 INSM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419479 Transient overexpression lysate of insulinoma-associated 1 (INSM1) 100 ug
$665.00
TP315007 Recombinant protein of human insulinoma-associated 1 (INSM1), 20 µg 20 ug
$737.00
TP762666 Purified recombinant protein of Human insulinoma-associated 1 (INSM1), 251Glu-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.