BATF3 (NM_018664) Human Mass Spec Standard

SKU
PH315000
BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215000]
Predicted MW 14.5 kDa
Protein Sequence
Protein Sequence
>RC215000 protein sequence
Red=Cloning site Green=Tags(s)

MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL
EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061134
RefSeq Size 992
RefSeq ORF 381
Synonyms JDP1; JUNDM1; SNFT
Locus ID 55509
UniProt ID Q9NR55
Cytogenetics 1q32.3
Summary This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:BATF3 (NM_018664) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412970 BATF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412970 Transient overexpression lysate of basic leucine zipper transcription factor, ATF-like 3 (BATF3) 100 ug
$436.00
TP315000 Recombinant protein of human basic leucine zipper transcription factor, ATF-like 3 (BATF3), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.