KIST (UHMK1) (NM_175866) Human Mass Spec Standard

SKU
PH314962
UHMK1 MS Standard C13 and N15-labeled recombinant protein (NP_787062)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214962]
Predicted MW 46.4 kDa
Protein Sequence
Protein Sequence
>RC214962 representing NM_175866
Red=Cloning site Green=Tags(s)

MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAE
YGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCAR
DVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQ
AGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDL
IKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEE
CQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_787062
RefSeq Size 2901
RefSeq ORF 1257
Synonyms KIS; KIST; P-CIP2
Locus ID 127933
UniProt ID Q8TAS1
Cytogenetics 1q23.3
Summary The gene encodes a serine/threonine protein kinase that promotes cell cycle progression through G1 by phosphorylation of the cyclin-dependent kinase inhibitor 1B (p27Kip1), which causes nuclear export and degradation. The encoded protein is also thought to function in the adult nervous system and the gene has been associated with schizophrenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:KIST (UHMK1) (NM_175866) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406187 UHMK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432915 UHMK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406187 Transient overexpression lysate of U2AF homology motif (UHM) kinase 1 (UHMK1) 100 ug
$665.00
LY432915 Transient overexpression lysate of U2AF homology motif (UHM) kinase 1 (UHMK1), transcript variant 3 100 ug
$436.00
TP314962 Recombinant protein of human U2AF homology motif (UHM) kinase 1 (UHMK1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.