OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VKORC1 (NM_206824) Human Mass Spec Standard

Be the first to review this product
SKU
PH314831
VKORC1 MS Standard C13 and N15-labeled recombinant protein (NP_996560)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320006 Rabbit Polyclonal VKORC1 Antibody
100 ug
$640.00
LY402968 Transient overexpression lysate of vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "VKORC1 or NM_206824"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214831
Predicted MW 9.7 kDa
Protein Sequence
Protein Sequence
>RC214831 representing NM_206824
Red=Cloning site Green=Tags(s)

MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDA
AELPGVSRWFCLPGLDPVLRAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996560
RefSeq Size 907
RefSeq ORF 276
Synonyms EDTP308; MST134; MST576; VKCFD2; VKOR
Locus ID 79001
UniProt ID Q9BQB6
Cytogenetics 16p11.2
Summary This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2015
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VKORC1" proteins (3)
SKU Description Size Price
LC402968 Lyophilized VKORC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402968 Transient overexpression lysate of vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP314831 Recombinant protein of human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products