CABYR (NM_012189) Human Mass Spec Standard

SKU
PH314772
CABYR MS Standard C13 and N15-labeled recombinant protein (NP_036321)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214772]
Predicted MW 52.6 kDa
Protein Sequence
Protein Sequence
>RC214772 representing NM_012189
Red=Cloning site Green=Tags(s)

MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKW
SEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGL
SSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVP
SSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVT
LQADIEVMSTVHISSVYNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEK
TTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE
VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGES
TAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036321
RefSeq Size 2333
RefSeq ORF 1479
Synonyms CABYRa; CABYRc; CABYRc/d; CABYRe; CBP86; CT88; FSP-2; FSP2
Locus ID 26256
UniProt ID O75952
Cytogenetics 18q11.2
Summary To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:CABYR (NM_012189) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406955 CABYR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406956 CABYR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406957 CABYR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408542 CABYR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408543 CABYR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415918 CABYR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406955 Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 2 100 ug
$665.00
LY406956 Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 7 100 ug
$436.00
LY406957 Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 6 100 ug
$436.00
LY408542 Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 5 100 ug
$436.00
LY408543 Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 3 100 ug
$436.00
LY415918 Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 1 100 ug
$665.00
TP314772 Recombinant protein of human calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.