GOLPH2 (GOLM1) (NM_016548) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC214745] |
Predicted MW | 45.2 kDa |
Protein Sequence |
Protein Sequence
>RC214745 representing NM_016548
Red=Cloning site Green=Tags(s) MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEF QGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQ FQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRL QAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVV EDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD YNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_057632 |
RefSeq Size | 3080 |
RefSeq ORF | 1203 |
Synonyms | bA379P1.3; C9orf155; GOLPH2; GP73; HEL46; PSEC0257 |
Locus ID | 51280 |
UniProt ID | Q8NBJ4 |
Cytogenetics | 9q21.33 |
Summary | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300086 | GOLM1 MS Standard C13 and N15-labeled recombinant protein (NP_808800) | 10 ug |
$3,255.00
|
|
LC406091 | GOLM1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413906 | GOLM1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406091 | Transient overexpression lysate of golgi membrane protein 1 (GOLM1), transcript variant 2 | 100 ug |
$436.00
|
|
LY413906 | Transient overexpression lysate of golgi membrane protein 1 (GOLM1), transcript variant 1 | 100 ug |
$436.00
|
|
TP300086 | Recombinant protein of human golgi membrane protein 1 (GOLM1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP314745 | Recombinant protein of human golgi membrane protein 1 (GOLM1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP721040 | Purified recombinant protein of Human golgi membrane protein 1 (GOLM1), transcript variant 2 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.