GOLPH2 (GOLM1) (NM_016548) Human Mass Spec Standard

SKU
PH314745
GOLM1 MS Standard C13 and N15-labeled recombinant protein (NP_057632)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214745]
Predicted MW 45.2 kDa
Protein Sequence
Protein Sequence
>RC214745 representing NM_016548
Red=Cloning site Green=Tags(s)

MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEF
QGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQ
FQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRL
QAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVV
EDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD
YNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057632
RefSeq Size 3080
RefSeq ORF 1203
Synonyms bA379P1.3; C9orf155; GOLPH2; GP73; HEL46; PSEC0257
Locus ID 51280
UniProt ID Q8NBJ4
Cytogenetics 9q21.33
Summary The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Sep 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:GOLPH2 (GOLM1) (NM_016548) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300086 GOLM1 MS Standard C13 and N15-labeled recombinant protein (NP_808800) 10 ug
$3,255.00
LC406091 GOLM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413906 GOLM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406091 Transient overexpression lysate of golgi membrane protein 1 (GOLM1), transcript variant 2 100 ug
$436.00
LY413906 Transient overexpression lysate of golgi membrane protein 1 (GOLM1), transcript variant 1 100 ug
$436.00
TP300086 Recombinant protein of human golgi membrane protein 1 (GOLM1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314745 Recombinant protein of human golgi membrane protein 1 (GOLM1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721040 Purified recombinant protein of Human golgi membrane protein 1 (GOLM1), transcript variant 2 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.