ZNF205 (NM_003456) Human Mass Spec Standard

SKU
PH314738
ZNF205 MS Standard C13 and N15-labeled recombinant protein (NP_003447)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214738]
Predicted MW 60.6 kDa
Protein Sequence
Protein Sequence
>RC214738 protein sequence
Red=Cloning site Green=Tags(s)

MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDAQESLHIKMEPEEPHSEGASQEDGAQGA
WGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWSQMPVTFEDVALYLSREEWGR
LDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTS
SVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPE
KPNEEEKGAPESGEEGLAPDSEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSH
LIQHQIIHTGEKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSH
LTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPAPT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003447
RefSeq Size 2077
RefSeq ORF 1662
Synonyms RhitH; Zfp13; ZNF210
Locus ID 7755
UniProt ID O95201
Cytogenetics 16p13.3
Summary May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF205 (NM_003456) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301174 ZNF205 MS Standard C13 and N15-labeled recombinant protein (NP_001035893) 10 ug
$3,255.00
LC418666 ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420898 ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418666 Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 1 100 ug
$436.00
LY420898 Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 2 100 ug
$436.00
TP301174 Purified recombinant protein of Homo sapiens zinc finger protein 205 (ZNF205), transcript variant 2, 20 µg 20 ug
$737.00
TP314738 Purified recombinant protein of Homo sapiens zinc finger protein 205 (ZNF205), transcript variant 1, 20 µg 20 ug
$737.00
TP761639 Purified recombinant protein of Human zinc finger protein 205 (ZNF205), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.