HSPB2 (NM_001541) Human Mass Spec Standard

SKU
PH314718
HSPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001532)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214718]
Predicted MW 20.2 kDa
Protein Sequence
Protein Sequence
>RC214718 protein sequence
Red=Cloning site Green=Tags(s)

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLS
EGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDG
ILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001532
RefSeq Size 858
RefSeq ORF 546
Synonyms Hs.78846; HSP27; LOH11CR1K; MKBP
Locus ID 3316
UniProt ID Q16082
Cytogenetics 11q23.1
Summary The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. This protein regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:HSPB2 (NM_001541) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419871 HSPB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419871 Transient overexpression lysate of heat shock 27kDa protein 2 (HSPB2) 100 ug
$436.00
TP314718 Recombinant protein of human heat shock 27kDa protein 2 (HSPB2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721195 Purified recombinant protein of Human heat shock 27kDa protein 2 (HSPB2) 10 ug
$185.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.