OTC (Ornithine Carbamoyltransferase (OTC)) (NM_000531) Mass Spec Standard

SKU
PH314662
OTC MS Standard C13 and N15-labeled recombinant protein (NP_000522)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214662]
Predicted MW 39.94 kDa
Protein Sequence
Protein Sequence
>RC214662 representing NM_000531
Red=Cloning site Green=Tags(s)

MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK
GEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLA
RVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAK
FGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQA
FQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQ
KPKF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000522
RefSeq Size 1927
RefSeq ORF 1062
Synonyms OCTD; OTCD
Locus ID 5009
UniProt ID P00480
Cytogenetics Xp11.4
Summary This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:OTC (Ornithine Carbamoyltransferase (OTC)) (NM_000531) Mass Spec Standard
Your Rating
SKU Description Size Price
LY400179 Transient overexpression lysate of ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein 100 ug
$424.00
TP314662 Purified recombinant protein of Homo sapiens ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00
TP710189 Purified recombinant protein of Human ornithine carbamoyltransferase (OTC / OCTD), nuclear gene encoding mitochondrial protein, residues 33-354 aa, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP760822 Purified recombinant protein of Human ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.