OTC (Ornithine Carbamoyltransferase (OTC)) (NM_000531) Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC214662] |
Predicted MW | 39.94 kDa |
Protein Sequence |
Protein Sequence
>RC214662 representing NM_000531
Red=Cloning site Green=Tags(s) MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK GEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLA RVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAK FGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQA FQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQ KPKF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_000522 |
RefSeq Size | 1927 |
RefSeq ORF | 1062 |
Synonyms | OCTD; OTCD |
Locus ID | 5009 |
UniProt ID | P00480 |
Cytogenetics | Xp11.4 |
Summary | This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LY400179 | Transient overexpression lysate of ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein | 100 ug |
$424.00
|
|
TP314662 | Purified recombinant protein of Homo sapiens ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein, 20 µg | 20 ug |
$737.00
|
|
TP710189 | Purified recombinant protein of Human ornithine carbamoyltransferase (OTC / OCTD), nuclear gene encoding mitochondrial protein, residues 33-354 aa, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
TP760822 | Purified recombinant protein of Human ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.