MALT1 (NM_006785) Human Mass Spec Standard

SKU
PH314639
MALT1 MS Standard C13 and N15-labeled recombinant protein (NP_006776)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214639]
Predicted MW 92.1 kDa
Protein Sequence
Protein Sequence
>RC214639 representing NM_006785
Red=Cloning site Green=Tags(s)

MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLS
CLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLA
GQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCD
IPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYV
DLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGN
MNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGY
ATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRAL
TDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDA
YVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVE
DKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSN
VTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006776
RefSeq Size 5029
RefSeq ORF 2472
Synonyms IMD12; MLT; MLT1; PCASP1
Locus ID 10892
UniProt ID Q9UDY8
Cytogenetics 18q21.32
Summary This gene encodes a caspase-like protease that plays a role in BCL10-induced activation of NF-kappaB. The protein is a component of the CARMA1-BCL10-MALT1 (CBM) signalosome that triggers NF-kappaB signaling and lymphoctye activation following antigen-receptor stimulation. Mutations in this gene result in immunodeficiency 12 (IMD12). This gene has been found to be recurrently rearranged in chromosomal translocations with other genes in mucosa-associated lymphoid tissue lymphomas, including a t(11;18)(q21;q21) translocation with the baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) locus [BIRC3(API2)-MALT1], and a t(14;18)(q32;q21) translocation with the immunoglobulin heavy chain locus (IGH-MALT1). Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2018]
Protein Families Druggable Genome, Protease
Protein Pathways B cell receptor signaling pathway, T cell receptor signaling pathway
Write Your Own Review
You're reviewing:MALT1 (NM_006785) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304322 MALT1 MS Standard C13 and N15-labeled recombinant protein (NP_776216) 10 ug
$3,255.00
LC402030 MALT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406281 MALT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402030 Transient overexpression lysate of mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 1 100 ug
$665.00
LY406281 Transient overexpression lysate of mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 2 100 ug
$436.00
TP304322 Purified recombinant protein of Homo sapiens mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 2, 20 µg 20 ug
$737.00
TP314639 Recombinant protein of human mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.