OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CA5A (NM_001739) Human Mass Spec Standard

Be the first to review this product
SKU
PH314555
CA5A MS Standard C13 and N15-labeled recombinant protein (NP_001730)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA313539 Rabbit polyclonal anti-CA5A antibody
100 ul
$380.00
LY419773 Transient overexpression lysate of carbonic anhydrase VA, mitochondrial (CA5A), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "CA5A or NM_001739"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214555
Predicted MW 34.75 kDa
Protein Sequence
Protein Sequence
>RC214555 representing NM_001739
Red=Cloning site Green=Tags(s)

MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQ
WRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGG
SEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARA
AMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNN
YRPLQPLMNRKVWASFQATNEGTRS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001730
RefSeq Size 1084
RefSeq ORF 915
Synonyms CA5; CA5AD; CAV; CAVA; GS1-21A4.1
Locus ID 763
UniProt ID P35218
Cytogenetics 16q24.2
Summary Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Nitrogen metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CA5A" proteins (3)
SKU Description Size Price
LC419773 Lyophilized CA5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419773 Transient overexpression lysate of carbonic anhydrase VA, mitochondrial (CA5A), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP314555 Recombinant protein of human carbonic anhydrase VA, mitochondrial (CA5A), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products