PGP (NM_001042371) Human Mass Spec Standard

SKU
PH314470
PGP MS Standard C13 and N15-labeled recombinant protein (NP_001035830)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214470]
Predicted MW 33.8 kDa
Protein Sequence
Protein Sequence
>RC214470 representing NM_001042371
Red=Cloning site Green=Tags(s)

MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNS
SKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVAS
VGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGR
FIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTL
TGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035830
RefSeq Size 1041
RefSeq ORF 963
Synonyms AUM; G3PP; PGPase
Locus ID 283871
UniProt ID A6NDG6
Cytogenetics 16p13.3
Summary Glycerol-3-phosphate phosphatase hydrolyzing glycerol-3-phosphate into glycerol. Thereby, regulates the cellular levels of glycerol-3-phosphate a metabolic intermediate of glucose, lipid and energy metabolism. Was also shown to have a 2-phosphoglycolate phosphatase activity and a tyrosine-protein phosphatase activity. However, their physiological relevance is unclear (PubMed:26755581). In vitro, has also a phosphatase activity toward ADP, ATP, GDP and GTP (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Pathways Glyoxylate and dicarboxylate metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:PGP (NM_001042371) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420860 PGP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420860 Transient overexpression lysate of phosphoglycolate phosphatase (PGP) 100 ug
$436.00
TP314470 Recombinant protein of human phosphoglycolate phosphatase (PGP), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.