UHRF1 (NM_013282) Human Mass Spec Standard

SKU
PH314251
UHRF1 MS Standard C13 and N15-labeled recombinant protein (NP_037414)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214251]
Predicted MW 90.9 kDa
Protein Sequence
Protein Sequence
>RC214251 representing NM_013282
Red=Cloning site Green=Tags(s)

MGVFAVPPLSSDTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHT
LFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMW
DETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVV
QMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLN
DCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECD
MAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRT
KECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFT
YTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKY
APAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALAN
REREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIRED
KSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVF
SCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037414
RefSeq Size 4086
RefSeq ORF 2418
Synonyms hNP95; hUHRF1; huNp95; ICBP90; Np95; RNF106; TDRD22
Locus ID 29128
UniProt ID Q96T88
Cytogenetics 19p13.3
Summary This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12. [provided by RefSeq, Feb 2014]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:UHRF1 (NM_013282) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415692 UHRF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420780 UHRF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415692 Transient overexpression lysate of ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 2 100 ug
$436.00
LY420780 Transient overexpression lysate of ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 1 100 ug
$665.00
TP314251 Recombinant protein of human ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.