C5ORF33 (NADK2) (NM_001085411) Human Mass Spec Standard

SKU
PH314147
C5orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001078880)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214147]
Predicted MW 49.3 kDa
Protein Sequence
Protein Sequence
>RC214147 representing NM_001085411
Red=Cloning site Green=Tags(s)

MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGSRADGGFRPSR
VVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRNEGIEVRLVK
RREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFY
RGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFI
GESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSLPLNR
ELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFN
DGAIASMMINKEDELRTVLLEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001078880
RefSeq Size 3898
RefSeq ORF 1326
Synonyms C5orf33; DECRD; MNADK; NADKD1
Locus ID 133686
UniProt ID Q4G0N4
Cytogenetics 5p13.2
Summary This gene encodes a mitochondrial kinase that catalyzes the phosphorylation of NAD to yield NADP. Mutations in this gene result in 2,4-dienoyl-CoA reductase deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:C5ORF33 (NADK2) (NM_001085411) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407195 NADK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421290 NADK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407195 Transient overexpression lysate of chromosome 5 open reading frame 33 (C5orf33), transcript variant 2 100 ug
$436.00
LY421290 Transient overexpression lysate of chromosome 5 open reading frame 33 (C5orf33), transcript variant 1 100 ug
$665.00
TP314147 Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 1, 20 µg 20 ug
$737.00
TP760230 Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00
TP760315 Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.