YY1 associated factor 2 (YAF2) (NM_005748) Human Mass Spec Standard

SKU PH314071

YAF2 MS Standard C13 and N15-labeled recombinant protein (NP_005739)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC214071]
• Predicted MW: 19.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC214071 representing NM_005748; Red=Cloning site Green=Tags(s); ; MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP; PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS; SAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005739
• RefSeq Size: 4096
• RefSeq ORF: 540
• Locus ID: 10138
• UniProt ID: Q8IY57
• Cytogenetics: 12q12
• Summary: This gene encodes a zinc finger containing protein that functions in the regulation of transcription. This protein was identified as an interacting partner of transcriptional repressor protein Yy1, and also interacts with other transcriptional regulators, including Myc and Polycomb. This protein can promote proteolysis of Yy1. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome, Transcription Factors