B3GNT6 (NM_138706) Human Mass Spec Standard

SKU
PH314024
B3GNT6 MS Standard C13 and N15-labeled recombinant protein (NP_619651)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214024]
Predicted MW 42.7 kDa
Protein Sequence
Protein Sequence
>RC214024 protein sequence
Red=Cloning site Green=Tags(s)

MAFPCRRSLTAKTLACLLVGVSFLALQQWFLQAPRSPREERSPQEETPEGPTDAPAADEPPSELVPGPPC
VANASANATADFEQLPARIQDFLRYRHCRHFPLLWDAPAKCAGGRGVFLLLAVKSAPEHYERRELIRRTW
GQERSYGGRPVRRLFLLGTPGPEDEARAERLAELVALEAREHGDVLQWAFADTFLNLTLKHLHLLDWLAA
RCPHARFLLSGDDDVFVHTANVVRFLQAQPPGRHLFSGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYC
SGGGFLLSGPTARALRAAARHTPLFPIDDAYMGMCLERAGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYR
ELLLVHRFAPYEMLLMWKALHSPALSCDRGHRVS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_619651
RefSeq Size 2560
RefSeq ORF 1152
Synonyms 3-Gn-T6; B3Gn-T6; beta-1; beta3Gn-T6; BGnT-6
Locus ID 192134
UniProt ID Q6ZMB0
Cytogenetics 11q13.5
Summary The protein encoded by this gene is a beta-1,3-N-acetylglucosaminyltransferase that adds an N-acetylglucosamine moiety to N-acetylgalactosamine-modified serine or threonine. The encoded enzyme is responsible for creating the core 3 structure of O-glycans, which are important components of mucin-type glycoproteins. [provided by RefSeq, Dec 2016]
Protein Pathways Metabolic pathways, O-Glycan biosynthesis
Write Your Own Review
You're reviewing:B3GNT6 (NM_138706) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408556 B3GNT6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408556 Transient overexpression lysate of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase) (B3GNT6) 100 ug
$436.00
TP314024 Recombinant protein of human UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase) (B3GNT6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.