Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001001435) Human Mass Spec Standard

SKU PH313959

CCL4L1 MS Standard C13 and N15-labeled recombinant protein (NP_001001435)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC213959]
• Predicted MW: 10.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC213959 protein sequence; Red=Cloning site Green=Tags(s); ; MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRG; KQVCADPSESWVQEYVYDLELN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001001435
• RefSeq Size: 674
• RefSeq ORF: 276
• Synonyms: AT744.2; CCL4L; LAG-1; LAG1; SCYA4L
• Locus ID: 9560
• UniProt ID: Q8NHW4
• Cytogenetics: 17q12
• Summary: This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. This gene copy contains a non-consensus splice acceptor site at the 3' terminal exon found in other highly similar gene copies, and it thus uses other alternative splice sites for the 3' terminal exon, resulting in multiple transcript variants. [provided by RefSeq, Apr 2014]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway