ADPRM (NM_020233) Human Mass Spec Standard

SKU
PH313957
C17orf48 MS Standard C13 and N15-labeled recombinant protein (NP_064618)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213957]
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC213957 representing NM_020233
Red=Cloning site Green=Tags(s)

MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVL
QLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPE
TMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQF
NGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTH
DGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064618
RefSeq Size 1518
RefSeq ORF 1026
Synonyms C17orf48; MDS006; NBLA03831
Locus ID 56985
UniProt ID Q3LIE5
Cytogenetics 17p13.1
Summary Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ADPRM (NM_020233) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412569 ADPRM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412569 Transient overexpression lysate of chromosome 17 open reading frame 48 (C17orf48) 100 ug
$436.00
TP313957 Recombinant protein of human chromosome 17 open reading frame 48 (C17orf48), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.