SNAI3 (NM_178310) Human Mass Spec Standard

SKU
PH313897
SNAI3 MS Standard C13 and N15-labeled recombinant protein (NP_840101)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213897]
Predicted MW 32.3 kDa
Protein Sequence
Protein Sequence
>RC213897 representing NM_178310
Red=Cloning site Green=Tags(s)

MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISL
PLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLL
GAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCT
CKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLL
ARHEESGCCPGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_840101
RefSeq Size 1630
RefSeq ORF 876
Synonyms SMUC; SNAIL3; Zfp293; ZNF293
Locus ID 333929
UniProt ID Q3KNW1
Cytogenetics 16q24.2
Summary SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).[supplied by OMIM, Apr 2009]
Write Your Own Review
You're reviewing:SNAI3 (NM_178310) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405994 SNAI3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405994 Transient overexpression lysate of snail homolog 3 (Drosophila) (SNAI3) 100 ug
$436.00
TP313897 Recombinant protein of human snail homolog 3 (Drosophila) (SNAI3), 20 µg 20 ug
$737.00
TP761526 Purified recombinant protein of Human snail homolog 3 (Drosophila) (SNAI3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.