SNAI3 (NM_178310) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC213897] |
Predicted MW | 32.3 kDa |
Protein Sequence |
Protein Sequence
>RC213897 representing NM_178310
Red=Cloning site Green=Tags(s) MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISL PLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLL GAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCT CKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLL ARHEESGCCPGP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_840101 |
RefSeq Size | 1630 |
RefSeq ORF | 876 |
Synonyms | SMUC; SNAIL3; Zfp293; ZNF293 |
Locus ID | 333929 |
UniProt ID | Q3KNW1 |
Cytogenetics | 16q24.2 |
Summary | SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).[supplied by OMIM, Apr 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC405994 | SNAI3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405994 | Transient overexpression lysate of snail homolog 3 (Drosophila) (SNAI3) | 100 ug |
$436.00
|
|
TP313897 | Recombinant protein of human snail homolog 3 (Drosophila) (SNAI3), 20 µg | 20 ug |
$737.00
|
|
TP761526 | Purified recombinant protein of Human snail homolog 3 (Drosophila) (SNAI3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.