OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD96 (NM_198196) Human Mass Spec Standard

Be the first to review this product
SKU
PH313845
CD96 MS Standard C13 and N15-labeled recombinant protein (NP_937839)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358795 CD96 Antibody - C-terminal region
100 ul
$585.00
LY417050 Transient overexpression lysate of CD96 molecule (CD96), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "CD96 or NM_198196"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213845
Predicted MW 63 kDa
Protein Sequence
Protein Sequence
>RC213845 representing NM_198196
Red=Cloning site Green=Tags(s)

MEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAV
YHPQYGFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYNLLIQTHV
TADEWNSNHTIEIEINQTLEIPCFQNSSSKISSEFTYAWSVENSSTDSWVLLSKGIKEDNGTQETLISQN
HLISNSTLLKDRVKLGTDYRLHLSPVQIFDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVIVENNST
DVLVERRFTCLLKNVFPKANITWFIDGSFLHDEKEGIYITNEERKGKDGFLELKSVLTRVHSNKPAQSDN
LTIWCMALSPVPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLV
DVSALRPNTTPQPSNSSMTTRGFNYPWTSSGTDTKKSVSRIPSETYSSSPSGAGSTLHDNVFTSTARAFS
EVPTTANGSTKTNHVHITGIVVNKPKDGMSWPVIVAALLFCCMILFGLGVRKWCQYQKEIMERPPPFKPP
PPPIKYTCIQEPNESDLPYHEMETL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_937839
RefSeq Size 4561
RefSeq ORF 1755
Synonyms TACTILE
Locus ID 10225
UniProt ID P40200
Cytogenetics 3q13.13-q13.2
Summary The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also function in antigen presentation. Alternative splicing generates multiple transcript variants encoding distinct isoforms. provided by RefSeq, Jan 2016
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD96" proteins (4)
SKU Description Size Price
LC417050 Lyophilized CD96 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417050 Transient overexpression lysate of CD96 molecule (CD96), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP313845 Recombinant protein of human CD96 molecule (CD96), transcript variant 1, 20 µg 20 ug
$867.00
TP723951 Recombinant human CD96 protein with C-terminal mouse Fc and 6×His tag 100 ug
$795.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products