Paxillin (PXN) (NM_002859) Human Mass Spec Standard

SKU
PH313811
PXN MS Standard C13 and N15-labeled recombinant protein (NP_002850)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213811]
Predicted MW 60.8 kDa
Protein Sequence
Protein Sequence
>RC213811 representing NM_002859
Red=Cloning site Green=Tags(s)

MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQ
PSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGS
NLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGL
EDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKFMA
QGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVC
THCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEG
FHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCE
VHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002850
RefSeq Size 3595
RefSeq ORF 1671
Locus ID 5829
UniProt ID P49023
Cytogenetics 12q24.23
Summary This gene encodes a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. These isoforms exhibit different expression pattern, and have different biochemical, as well as physiological properties (PMID:9054445). [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, VEGF signaling pathway
Write Your Own Review
You're reviewing:Paxillin (PXN) (NM_002859) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401010 PXN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425922 PXN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429750 PXN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401010 Transient overexpression lysate of paxillin (PXN), transcript variant 2 100 ug
$665.00
LY425922 Transient overexpression lysate of paxillin (PXN), transcript variant 1 100 ug
$436.00
LY429750 Transient overexpression lysate of paxillin (PXN), transcript variant 3 100 ug
$436.00
TP313811 Recombinant protein of human paxillin (PXN), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760834 Purified recombinant protein of Human paxillin (PXN), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.