DCL 1 (CD302) (NM_014880) Human Mass Spec Standard

SKU
PH313785
CD302 MS Standard C13 and N15-labeled recombinant protein (NP_055695)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213785]
Predicted MW 26 kDa
Protein Sequence
Protein Sequence
>RC213785 representing NM_014880
Red=Cloning site Green=Tags(s)

MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEE
ENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKK
GNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQ
SPYNEDCVLVVGEENEYPVQFD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055695
RefSeq Size 3740
RefSeq ORF 696
Synonyms BIMLEC; CLEC13A; DCL-1; DCL1
Locus ID 9936
UniProt ID Q8IX05
Cytogenetics 2q24.2
Summary CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 [PubMed 17947679]).[supplied by OMIM, Aug 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:DCL 1 (CD302) (NM_014880) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402391 CD302 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434014 CD302 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402391 Transient overexpression lysate of CD302 molecule (CD302) 100 ug
$436.00
LY434014 Transient overexpression lysate of CD302 molecule (CD302), transcript variant 2 100 ug
$436.00
TP313785 Recombinant protein of human CD302 molecule (CD302), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.