SLC39A7 (NM_001077516) Human Mass Spec Standard

SKU
PH313722
SLC39A7 MS Standard C13 and N15-labeled recombinant protein (NP_001070984)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213722]
Predicted MW 50.1 kDa
Protein Sequence
Protein Sequence
>RC213722 protein sequence
Red=Cloning site Green=Tags(s)

MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSHAHGHGHTHES
IWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALG
ATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHTLEQPGHGHSH
SGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEE
KETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGIL
TTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL
PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001070984
RefSeq Size 2172
RefSeq ORF 1407
Synonyms D6S115E; D6S2244E; H2-KE4; HKE4; KE4; RING5; ZIP7
Locus ID 7922
UniProt ID Q92504
Cytogenetics 6p21.32
Summary The protein encoded by this gene transports zinc from the Golgi and endoplasmic reticulum to the cytoplasm. This transport may be important for activation of tyrosine kinases, some of which could be involved in cancer progression. Therefore, modulation of the encoded protein could be useful as a therapeutic agent against cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SLC39A7 (NM_001077516) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416296 SLC39A7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421455 SLC39A7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416296 Transient overexpression lysate of solute carrier family 39 (zinc transporter), member 7 (SLC39A7), transcript variant 1 100 ug
$436.00
LY421455 Transient overexpression lysate of solute carrier family 39 (zinc transporter), member 7 (SLC39A7), transcript variant 2 100 ug
$665.00
TP313722 Recombinant protein of human solute carrier family 39 (zinc transporter), member 7 (SLC39A7), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.