UBE2Q1 (NM_017582) Human Mass Spec Standard

SKU
PH313678
UBE2Q1 MS Standard C13 and N15-labeled recombinant protein (NP_060052)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213678]
Predicted MW 45.9 kDa
Protein Sequence
Protein Sequence
>RC213678 representing NM_017582
Red=Cloning site Green=Tags(s)

MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFRIASACLDELS
CEFLLAGAGGAGAGAAPGPHLPPRGSVPGDPVRIHCNITESYPAVPPIWSVESDDPNLAAVLERLVDIKK
GNTLLLQHLKRIISDLCKLYNLPQHPDVEMLDQPLPAEQCTQEDVSSEDEDEEMPEDTEDLDHYEMKEEE
PAEGKKSEDDGIGKENLAILEKIKKNQRQDYLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVN
DSLYDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAI
CMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKE
DG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060052
RefSeq Size 3223
RefSeq ORF 1266
Synonyms GTAP; NICE-5; NICE5; PRO3094; UBE2Q
Locus ID 55585
UniProt ID Q7Z7E8
Cytogenetics 1q21.3
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is 98% identical to the mouse counterpart. [provided by RefSeq, Jul 2008]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE2Q1 (NM_017582) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413677 UBE2Q1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413677 Transient overexpression lysate of ubiquitin-conjugating enzyme E2Q family member 1 (UBE2Q1) 100 ug
$665.00
TP313678 Recombinant protein of human ubiquitin-conjugating enzyme E2Q family member 1 (UBE2Q1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.