OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SETD6 (NM_024860) Human Mass Spec Standard

Be the first to review this product
SKU
PH313656
SETD6 MS Standard C13 and N15-labeled recombinant protein (NP_079136)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339159 Rabbit Polyclonal Anti-SETD6
100 ul
$585.00
LY411026 Transient overexpression lysate of SET domain containing 6 (SETD6), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "SETD6 or NM_024860"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213656
Predicted MW 50.6 kDa
Protein Sequence
Protein Sequence
>RC213656 representing NM_024860
Red=Cloning site Green=Tags(s)

MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVAVSRQGTVAGYGMVARESVQAGELLFVVPR
AALLSQHTCSIGGLLERERVALQSQSGWVPLLLALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEER
RCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEED
EKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYP
DNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREEVLTEEELTTTLKVL
CMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVY
AKLSWREQQALQVRYGQKMILHQLLELTS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079136
RefSeq Size 1999
RefSeq ORF 1347
Locus ID 79918
UniProt ID Q8TBK2
Cytogenetics 16q21
Summary This gene encodes a methyltransferase that adds a methyl group to the histone H2AZ, which is involved in nuclear receptor-dependent transcription. The protein also interacts with several endogenous proteins which are involved in nuclear hormone receptor signaling. A related pseudogene is located on chromosome 2. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SETD6" proteins (3)
SKU Description Size Price
LC411026 Lyophilized SETD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411026 Transient overexpression lysate of SET domain containing 6 (SETD6), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP313656 Recombinant protein of human SET domain containing 6 (SETD6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products