RPS6KA3 (NM_004586) Human Mass Spec Standard

SKU
PH313645
RPS6KA3 MS Standard C13 and N15-labeled recombinant protein (NP_004577)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213645]
Predicted MW 83.7 kDa
Protein Sequence
Protein Sequence
>RC213645 protein sequence
Red=Cloning site Green=Tags(s)

MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFEL
LKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTE
GKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLT
DFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMI
LKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGR
PEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVY
VVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRIC
DFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEIL
ARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK
GAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004577
RefSeq Size 7723
RefSeq ORF 2220
Synonyms CLS; HU-3; ISPK-1; MAPKAPK1B; MRX19; p90-RSK2; pp90RSK2; RSK; RSK2; S6K-alpha3
Locus ID 6197
UniProt ID P51812
Cytogenetics Xp22.12
Summary This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS). [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Long-term potentiation, MAPK signaling pathway, mTOR signaling pathway, Neurotrophin signaling pathway, Oocyte meiosis, Progesterone-mediated oocyte maturation
Write Your Own Review
You're reviewing:RPS6KA3 (NM_004586) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417887 RPS6KA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417887 Transient overexpression lysate of ribosomal protein S6 kinase, 90kDa, polypeptide 3 (RPS6KA3) 100 ug
$665.00
TP313645 Recombinant protein of human ribosomal protein S6 kinase, 90kDa, polypeptide 3 (RPS6KA3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.