Pannexin 2 (PANX2) (NM_052839) Human Mass Spec Standard

SKU
PH313641
PANX2 MS Standard C13 and N15-labeled recombinant protein (NP_443071)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213641]
Predicted MW 74.3 kDa
Protein Sequence
Protein Sequence
>RC213641 representing NM_052839
Red=Cloning site Green=Tags(s)

MHHLLEQSADMATALLAGEKLRELILPGAQDDKAGALAALLLQLKLELPFDRVVTIGTVLVPILLVTLVF
TKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDALPGVDASLWPSLFEHKFLPYALLAFAAIMYVPAL
GWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKREIIENAEKEKSPEQNLF
EKYLERRGRSNFLAKLYLARHVLILLLSAVPISYLCTYYATQKQNEFTCALGASPDGAAGAGPAVRVSCK
LPSVQLQRIIAGVDIVLLCVMNLIILVNLIHLFIFRKSNFIFDKLHKVGIKTRRQWRRSQFCDINILAMF
CNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEP
PVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATDTLIAPLLDRSAHHYKGGGGD
PGPGPAPAPAPPPAPDKKHARHFSLDVHPYILGTKKAKAEAVPAALPASRSQEGGFLSQAEDCGLGLAPA
PIKDAPLPEKEIPYPTEPARAGLPSGGPFHVRSPPAAPAVAPLTPASLGKAEPLTILSRNATHPLLHINT
LYEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443071
RefSeq Size 3069
RefSeq ORF 2031
Synonyms hPANX2; PX2
Locus ID 56666
UniProt ID Q96RD6
Cytogenetics 22q13.33
Summary The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nervous system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Pannexin 2 (PANX2) (NM_052839) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409450 PANX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431543 PANX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409450 Transient overexpression lysate of pannexin 2 (PANX2), transcript variant 1 100 ug
$665.00
LY431543 Transient overexpression lysate of pannexin 2 (PANX2), transcript variant 2 100 ug
$436.00
TP313641 Recombinant protein of human pannexin 2 (PANX2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.