Tryptophanyl tRNA synthetase (WARS) (NM_173701) Human Mass Spec Standard

SKU
PH313605
WARS MS Standard C13 and N15-labeled recombinant protein (NP_776049)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213605]
Predicted MW 53.2 kDa
Protein Sequence
Protein Sequence
>RC213605 protein sequence
Red=Cloning site Green=Tags(s)

MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPT
SNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH
RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ
AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF
PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKM
SASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_776049
RefSeq Size 2660
RefSeq ORF 1413
Synonyms GAMMA-2; HMN9; IFI53; IFP53; WARS
Locus ID 7453
UniProt ID P23381
Cytogenetics 14q32.2
Summary Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Aminoacyl-tRNA biosynthesis, Tryptophan metabolism
Write Your Own Review
You're reviewing:Tryptophanyl tRNA synthetase (WARS) (NM_173701) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401346 WARS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406568 WARS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401346 Transient overexpression lysate of tryptophanyl-tRNA synthetase (WARS), transcript variant 1 100 ug
$436.00
LY406568 Transient overexpression lysate of tryptophanyl-tRNA synthetase (WARS), transcript variant 2 100 ug
$665.00
TP313605 Recombinant protein of human tryptophanyl-tRNA synthetase (WARS), transcript variant 2, 20 µg 20 ug
$737.00
TP720622 Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1 10 ug
$250.00
TP760112 Recombinant protein of human tryptophanyl-tRNA synthetase (WARS), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.