ARMETL1 (CDNF) (NM_001029954) Human Mass Spec Standard

SKU
PH313572
CDNF MS Standard C13 and N15-labeled recombinant protein (NP_001025125)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213572]
Predicted MW 21 kDa
Protein Sequence
Protein Sequence
>RC213572 protein sequence
Red=Cloning site Green=Tags(s)

MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISF
CLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLR
KMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001025125
RefSeq Size 1330
RefSeq ORF 561
Synonyms ARMETL1
Locus ID 441549
UniProt ID Q49AH0
Cytogenetics 10p13
Summary Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ARMETL1 (CDNF) (NM_001029954) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC422270 CDNF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422270 Transient overexpression lysate of cerebral dopamine neurotrophic factor (CDNF) 100 ug
$436.00
TP313572 Recombinant protein of human arginine-rich, mutated in early stage tumors-like 1 (ARMETL1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720771 Purified recombinant protein of Human cerebral dopamine neurotrophic factor (CDNF) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.