LCE3E (NM_178435) Human Mass Spec Standard

SKU
PH313561
LCE3E MS Standard C13 and N15-labeled recombinant protein (NP_848522)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213561]
Predicted MW 9.5 kDa
Protein Sequence
Protein Sequence
>RC213561 protein sequence
Red=Cloning site Green=Tags(s)

MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNS
CDRGSGQQGGGSGCCHGSGGCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848522
RefSeq Size 547
RefSeq ORF 276
Synonyms LEP17
Locus ID 353145
UniProt ID Q5T5B0
Cytogenetics 1q21.3
Summary Precursors of the cornified envelope of the stratum corneum.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LCE3E (NM_178435) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405959 LCE3E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405959 Transient overexpression lysate of late cornified envelope 3E (LCE3E) 100 ug
$436.00
TP313561 Recombinant protein of human late cornified envelope 3E (LCE3E), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.