C22orf9 (KIAA0930) (NM_015264) Human Mass Spec Standard

SKU
PH313426
C22orf9 MS Standard C13 and N15-labeled recombinant protein (NP_056079)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213426]
Predicted MW 46 kDa
Protein Sequence
Protein Sequence
>RC213426 representing NM_015264
Red=Cloning site Green=Tags(s)

MGSQAAAEWRNWASWEVSSSLSGCSMGCFKDDRIVFWTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSE
SGADGRKAAEPEVEVEVYRRDSKKLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKK
KSQQVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVASDKTNTFQGVIFQG
SIRYEALKKVYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVSTGDTSPCGTEEDS
SPASPMHERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNAT
NLRSRSLSGTGRSLVGSWLKLNRADGNFLLYAHLTYVTLPLHRILTDILEVRQKPILMT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056079
RefSeq Size 6287
RefSeq ORF 1227
Synonyms C22orf9; LSC3
Locus ID 23313
UniProt ID Q6ICG6
Cytogenetics 22q13.31
Write Your Own Review
You're reviewing:C22orf9 (KIAA0930) (NM_015264) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414655 KIAA0930 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414655 Transient overexpression lysate of chromosome 22 open reading frame 9 (C22orf9), transcript variant 1 100 ug
$436.00
TP313426 Recombinant protein of human chromosome 22 open reading frame 9 (C22orf9), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.