OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HMGN3 (NM_004242) Human Mass Spec Standard

Be the first to review this product
SKU
PH313403
HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_004233)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339226 Rabbit Polyclonal Anti-HMGN3
100 ul
$585.00
LY408537 Transient overexpression lysate of high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "HMGN3 or NM_004242"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213403
Predicted MW 10.5 kDa
Protein Sequence
Protein Sequence
>RC213403 representing NM_004242
Red=Cloning site Green=Tags(s)

MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA
GKEGTAPSENGETKAEEAQKTESVDNEGE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004233
RefSeq Size 935
RefSeq ORF 297
Synonyms PNAS-24; PNAS-25; TRIP7
Locus ID 9324
UniProt ID Q15651
Cytogenetics 6q14.1
Summary The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. provided by RefSeq, Jan 2016
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HMGN3" proteins (7)
SKU Description Size Price
PH302339 HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_620058) 10 ug
$3,360.00
LC408537 Lyophilized HMGN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418127 Lyophilized HMGN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408537 Transient overexpression lysate of high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418127 Transient overexpression lysate of high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302339 Recombinant protein of human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2, 20 µg 20 ug
$867.00
TP313403 Recombinant protein of human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products