HMGN3 (NM_004242) Human Mass Spec Standard

SKU PH313403

HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_004233)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC213403]
• Predicted MW: 10.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC213403 representing NM_004242; Red=Cloning site Green=Tags(s); ; MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA; GKEGTAPSENGETKAEEAQKTESVDNEGE; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004233
• RefSeq Size: 935
• RefSeq ORF: 297
• Synonyms: PNAS-24; PNAS-25; TRIP7
• Locus ID: 9324
• UniProt ID: Q15651
• Cytogenetics: 6q14.1
• Summary: The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome