ACVRL1 (NM_001077401) Human Mass Spec Standard

SKU
PH313389
ACVRL1 MS Standard C13 and N15-labeled recombinant protein (NP_001070869)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213389]
Predicted MW 56.1 kDa
Protein Sequence
Protein Sequence
>RC213389 protein sequence
Red=Cloning site Green=Tags(s)

MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCG
NLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGL
WHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGK
GRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYH
EHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLG
LAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED
YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQ
KISNSPEKPKVIQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001070869
RefSeq Size 4126
RefSeq ORF 1509
Synonyms ACVRLK1; ALK-1; ALK1; HHT; HHT2; ORW2; SKR3; TSR-I
Locus ID 94
UniProt ID P37023
Cytogenetics 12q13.13
Summary This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, TGF-beta signaling pathway
Write Your Own Review
You're reviewing:ACVRL1 (NM_001077401) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421410 ACVRL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421410 Transient overexpression lysate of activin A receptor type II-like 1 (ACVRL1), transcript variant 2 100 ug
$665.00
TP313389 Recombinant protein of human activin A receptor type II-like 1 (ACVRL1), transcript variant 2, 20 µg 20 ug
$737.00
TP761932 Purified recombinant protein of Human activin A receptor type II-like 1 (ACVRL1), transcript variant 1,Asp22-Leu119, with N-terminal His-ABP tag, expressed in E. coli, 50ug 50 ug
$261.00
TP762552 Purified recombinant protein of Human activin A receptor type II-like 1 (ACVRL1), transcript variant 1, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.