Tau (MAPT) (NM_016841) Human Mass Spec Standard

SKU
PH313364
MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213364]
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC213364 representing NM_016841
Red=Cloning site Green=Tags(s)

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMV
SKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYS
SPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKH
QPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNK
KIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQ
GL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_058525
RefSeq Size 2529
RefSeq ORF 1056
Synonyms DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU; tau-40
Locus ID 4137
UniProt ID P10636
Cytogenetics 17q21.31
Summary This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, MAPK signaling pathway
Write Your Own Review
You're reviewing:Tau (MAPT) (NM_016841) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313312 MAPT MS Standard C13 and N15-labeled recombinant protein (NP_005901) 10 ug
$3,255.00
PH317773 MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058518) 10 ug
$3,255.00
LC401790 MAPT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413819 MAPT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413820 MAPT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413823 MAPT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426599 MAPT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429527 MAPT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401790 Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 2 100 ug
$665.00
LY413819 Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 3 100 ug
$436.00
LY413820 Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 100 ug
$665.00
LY413823 Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 4 100 ug
$436.00
LY426599 Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 5 100 ug
$436.00
TP313312 Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 2, 20 µg 20 ug
$867.00
TP313364 Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 4, 20 µg 20 ug
$867.00
TP317773 Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 3, 20 µg 20 ug
$867.00
TP720155 Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 6 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.