OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NY-ESO-1 (CTAG1B) (NM_001327) Human Mass Spec Standard

Be the first to review this product
SKU
PH313318
CTAG1B (NY-ESO-1) MS Standard C13 and N15-labeled recombinant protein (NP_001318)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500528 Anti-CTAG1B (NY-ESO-1) mouse monoclonal antibody, clone OTI2B6 (formerly 2B6) 100 ul
$447.00
LY400527 Transient overexpression lysate of cancer/testis antigen 1B (CTAG1B/NY-ESO-1) (as WB positive control) 100 ug
$436.00

Other products for "NY-ESO-1 or NM_001327"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213318
Predicted MW 17.8 kDa
Protein Sequence
Protein Sequence
>RC213318 representing NM_001327
Red=Cloning site Green=Tags(s)

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS
GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA
DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001318
RefSeq Size 806
RefSeq ORF 540
Synonyms CT6.1; CTAG; CTAG1; ESO1; LAGE-2; LAGE2B; NY-ESO-1
Locus ID 1485
UniProt ID P78358
Cytogenetics Xq28
Summary The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. provided by RefSeq, Jan 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NY-ESO-1" proteins (4)
SKU Description Size Price
LC400527 Lyophilized CTAG1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400527 Transient overexpression lysate of cancer/testis antigen 1B (CTAG1B/NY-ESO-1) (as WB positive control) 100 ug
$436.00
TP313318 Recombinant protein of human cancer/testis antigen 1B (CTAG1B/NY-ESO-1), 20 µg 20 ug
$867.00
TP710205 Purified recombinant protein of Homo sapiens cancer/testis antigen 1B (CTAG1B), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products