NY-ESO-1 (CTAG1B) (NM_001327) Human Mass Spec Standard

SKU PH313318

CTAG1B (NY-ESO-1) MS Standard C13 and N15-labeled recombinant protein (NP_001318)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC213318]
• Predicted MW: 17.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC213318 representing NM_001327; Red=Cloning site Green=Tags(s); ; MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS; GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA; DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001318
• RefSeq Size: 806
• RefSeq ORF: 540
• Synonyms: CT6.1; CTAG; CTAG1; ESO1; LAGE-2; LAGE2B; NY-ESO-1
• Locus ID: 1485
• UniProt ID: P78358
• Cytogenetics: Xq28
• Summary: The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome