C17orf87 (SCIMP) (NM_207103) Human Mass Spec Standard

SKU PH313295

C17orf87 MS Standard C13 and N15-labeled recombinant protein (NP_996986)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC213295]
• Predicted MW: 16.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC213295 protein sequence; Red=Cloning site Green=Tags(s); ; MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYE; NVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANT; EKASF; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_996986
• RefSeq Size: 2424
• RefSeq ORF: 435
• Synonyms: C17orf87; UNQ5783
• Locus ID: 388325
• UniProt ID: Q6UWF3
• Cytogenetics: 17p13.2
• Summary: This gene encodes a transmembrane adaptor protein that is expressed in antigen-presenting cells and is localized in the immunologic synapse. The encoded protein is involved in major histocompatibility complex class II signal transduction and immune synapse formation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2012]
• Protein Families: Transmembrane