CYP4Z1 (NM_178134) Human Mass Spec Standard

SKU
PH313223
CYP4Z1 MS Standard C13 and N15-labeled recombinant protein (NP_835235)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213223]
Predicted MW 58.9 kDa
Protein Sequence
Protein Sequence
>RC213223 representing NM_178134
Red=Cloning site Green=Tags(s)

MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGHKEFYPVKEFEVYH
KLMEKYPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESWVGRGLVTLDGSKWKKHRQIV
KPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAFSHQGSIQLDSTLDS
YLKAVFNLSKISNQRMNNFLHHNDLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKR
RWDFLDILLSAKSENTKDFSEADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGD
GSSITWEHLSQMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWED
PQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVRQVV
LKSKNGIHVFAKKVC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_835235
RefSeq Size 1907
RefSeq ORF 1515
Synonyms CYP4A20
Locus ID 199974
UniProt ID Q86W10
Cytogenetics 1p33
Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 1p33. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, P450, Transmembrane
Write Your Own Review
You're reviewing:CYP4Z1 (NM_178134) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405940 CYP4Z1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405940 Transient overexpression lysate of cytochrome P450, family 4, subfamily Z, polypeptide 1 (CYP4Z1) 100 ug
$665.00
TP313223 Recombinant protein of human cytochrome P450, family 4, subfamily Z, polypeptide 1 (CYP4Z1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.