C8orf42 (TDRP) (NM_175075) Human Mass Spec Standard

SKU
PH313199
C8orf42 MS Standard C13 and N15-labeled recombinant protein (NP_778250)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213199]
Predicted MW 20.2 kDa
Protein Sequence
Protein Sequence
>RC213199 representing NM_175075
Red=Cloning site Green=Tags(s)

MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGA
RLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSP
KSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWE
DDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_778250
RefSeq Size 1901
RefSeq ORF 774
Synonyms C8orf42; Inm01; TDRP1; TDRP2
Locus ID 157695
UniProt ID Q86YL5
Cytogenetics 8p23.3
Summary Contributes to normal sperm motility, but not essential for male fertility.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C8orf42 (TDRP) (NM_175075) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406313 TDRP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406313 Transient overexpression lysate of chromosome 8 open reading frame 42 (C8orf42) 100 ug
$436.00
TP313199 Recombinant protein of human chromosome 8 open reading frame 42 (C8orf42), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.