KLF14 (NM_138693) Human Mass Spec Standard

SKU
PH313087
KLF14 MS Standard C13 and N15-labeled recombinant protein (NP_619638)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213087]
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC213087 representing NM_138693
Red=Cloning site Green=Tags(s)

MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESALPGPGPSGPASVPQLPQVP
APSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPCSVQTPCSELAPASGAAAVCA
PESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAADQAPRRRSVTPAAKRHQCPFPGCTKAYYKSS
HLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTY
HPDMIEYRGRRRTPRIDPPLTSEVESSASGSGPGPAPSFTTCL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_619638
RefSeq Size 1383
RefSeq ORF 969
Synonyms BTEB5
Locus ID 136259
UniProt ID Q8TD94
Cytogenetics 7q32.2
Summary This intronless gene encodes a member of the Kruppel-like family of transcription factors. The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene expression. This gene exhibits imprinted expression from the maternal allele in embryonic and extra-embryonic tissues. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:KLF14 (NM_138693) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408547 KLF14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408547 Transient overexpression lysate of Kruppel-like factor 14 (KLF14) 100 ug
$436.00
TP313087 Recombinant protein of human Kruppel-like factor 14 (KLF14), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.