OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EPS8L1 (NM_133180) Human Mass Spec Standard

Be the first to review this product
SKU
PH313074
EPS8L1 MS Standard C13 and N15-labeled recombinant protein (NP_573441)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344143 Rabbit Polyclonal Anti-EPS8L1 Antibody
100 ul
$585.00
LY413581 Transient overexpression lysate of EPS8-like 1 (EPS8L1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "EPS8L1 or NM_133180"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213074
Predicted MW 80.1 kDa
Protein Sequence
Protein Sequence
>RC213074 representing NM_133180
Red=Cloning site Green=Tags(s)

MSTATGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASRKLAVMDSQGR
VWAQEMLLRVSPDHVTLLDPASKEELESYPLGAIVRCDAVMPPGRSRSLLLLVCQEPERAQPDVHFFQGL
RLGAELIREDIQGALHNYRSGRGERRAAALRATQEELQRDRSPAAETPPLQRRPSVRAVISTVERGAGRG
RPQAKPIPEAEEAQRPEPVGTSSNADSASPDLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAE
AARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLF
GPLQMIVNTSGGPEFASSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEF
FSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVAVNGHRDLEPESEPQLESETAGKWVLCNYDFQ
ARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPGPRLHHSQSPARSLNSTPPPPPAP
APAPPPALARPRWDRPRWDSCDSLNGLDPSEKEKFSQMLIVNEELQARLAQGRSGPSRAVPGPRAPEPQL
SPGSDASEVRAWLQAKGFSSGTVDALGVLTGAQLFSLQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKV
SELEAVMEKQKKKVEGEVEMEVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_573441
RefSeq Size 2543
RefSeq ORF 2169
Synonyms DRC3; EPS8R1; PP10566
Locus ID 54869
UniProt ID Q8TE68
Cytogenetics 19q13.42
Summary This gene encodes a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. At least two alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EPS8L1" proteins (5)
SKU Description Size Price
PH304919 EPS8L1 MS Standard C13 and N15-labeled recombinant protein (NP_060199) 10 ug
$3,360.00
LC413581 Lyophilized EPS8L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413581 Transient overexpression lysate of EPS8-like 1 (EPS8L1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304919 Recombinant protein of human EPS8-like 1 (EPS8L1), transcript variant 2, 20 µg 20 ug
$867.00
TP313074 Recombinant protein of human EPS8-like 1 (EPS8L1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products