ARSA (NM_001085425) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC213072] |
Predicted MW | 53.81 kDa |
Protein Sequence |
Protein Sequence
>RC213072 representing NM_001085425
Red=Cloning site Green=Tags(s) MSMGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSL CTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPH QGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDL MADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIF TADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPL PNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASS SLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQIC CHPGCTPRPACCHCPDPHA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001078894 |
RefSeq Size | 1966 |
RefSeq ORF | 1527 |
Synonyms | ASA; MLD |
Locus ID | 410 |
UniProt ID | P15289 |
Cytogenetics | 22q13.33 |
Summary | The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome, Sphingolipid metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304319 | ARSA MS Standard C13 and N15-labeled recombinant protein (NP_000478) | 10 ug |
$3,255.00
|
|
PH313161 | ARSA MS Standard C13 and N15-labeled recombinant protein (NP_001078896) | 10 ug |
$3,255.00
|
|
LC421293 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC421294 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC421295 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424697 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425979 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY421293 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 2 | 100 ug |
$665.00
|
|
LY421294 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 3 | 100 ug |
$665.00
|
|
LY421295 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 4 | 100 ug |
$665.00
|
|
LY424697 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 1 | 100 ug |
$436.00
|
|
LY425979 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 2 | 100 ug |
$436.00
|
|
TP304319 | Recombinant protein of human arylsulfatase A (ARSA), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP313072 | Purified recombinant protein of Homo sapiens arylsulfatase A (ARSA), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP313161 | Purified recombinant protein of Homo sapiens arylsulfatase A (ARSA), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP720270 | Recombinant protein of human arylsulfatase A (ARSA), transcript variant 1 | 10 ug |
$285.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.