OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AKAP7 (NM_004842) Human Mass Spec Standard

Be the first to review this product
SKU
PH313040
AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA804819 AKAP7 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7) 100 ul
$447.00
LY429496 Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma (as WB positive control) 100 ug
$436.00

Other products for "AKAP7 or NM_004842"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213040
Predicted MW 8.8 kDa
Protein Sequence
Protein Sequence
>RC213040 representing NM_004842
Red=Cloning site Green=Tags(s)

MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAAD
QNGNDNENNRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004833
RefSeq Size 2279
RefSeq ORF 243
Synonyms AKAP15; AKAP18
Locus ID 9465
UniProt ID O43687
Cytogenetics 6q23.2
Summary This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.provided by RefSeq, Apr 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AKAP7" proteins (10)
SKU Description Size Price
PH323812 AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_619539) 10 ug
$3,360.00
LC413981 Lyophilized AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417708 Lyophilized AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429496 Lyophilized AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413981 Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma (as WB positive control) 100 ug
$436.00
LY417708 Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha (as WB positive control) 100 ug
$436.00
LY429496 Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma (as WB positive control) 100 ug
$436.00
TP313040 Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha, 20 µg 20 ug
$867.00
TP323812 Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta, 20 µg 20 ug
$867.00
TP760674 Purified recombinant protein of Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products