AKAP7 (NM_004842) Human Mass Spec Standard

SKU PH313040

AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC213040]
• Predicted MW: 8.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC213040 representing NM_004842; Red=Cloning site Green=Tags(s); ; MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAAD; QNGNDNENNRK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004833
• RefSeq Size: 2279
• RefSeq ORF: 243
• Synonyms: AKAP15; AKAP18
• Locus ID: 9465
• UniProt ID: O43687
• Cytogenetics: 6q23.2
• Summary: This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011]
• Protein Families: Druggable Genome