ALDH8A1 (NM_022568) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC213029] |
Predicted MW | 53.4 kDa |
Protein Sequence |
Protein Sequence
>RC213029 protein sequence
Red=Cloning site Green=Tags(s) MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERS RVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYT VRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGT GPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSF ANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGA QIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_072090 |
RefSeq Size | 2567 |
RefSeq ORF | 1461 |
Synonyms | ALDH12; DJ352A20.2 |
Locus ID | 64577 |
UniProt ID | Q9H2A2 |
Cytogenetics | 6q23.3 |
Summary | This gene encodes a member of the aldehyde dehydrogenase family of proteins. The encoded protein has been implicated in the synthesis of 9-cis-retinoic acid and in the breakdown of the amino acid tryptophan. This enzyme converts 9-cis-retinal into the retinoid X receptor ligand 9-cis-retinoic acid, and has approximately 40-fold higher activity with 9-cis-retinal than with all-trans-retinal. In addition, this enzyme has been shown to catalyze the conversion of 2-aminomuconic semialdehyde to 2-aminomuconate in the kynurenine pathway of tryptophan catabolism. [provided by RefSeq, Jul 2018] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC406874 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC411634 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC434230 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406874 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 2 | 100 ug |
$665.00
|
|
LY411634 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 1 | 100 ug |
$665.00
|
|
LY434230 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 3 | 100 ug |
$436.00
|
|
TP313029 | Recombinant protein of human aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.