ALDH8A1 (NM_022568) Human Mass Spec Standard

SKU
PH313029
ALDH8A1 MS Standard C13 and N15-labeled recombinant protein (NP_072090)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213029]
Predicted MW 53.4 kDa
Protein Sequence
Protein Sequence
>RC213029 protein sequence
Red=Cloning site Green=Tags(s)

MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERS
RVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYT
VRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGT
GPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSF
ANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGA
QIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_072090
RefSeq Size 2567
RefSeq ORF 1461
Synonyms ALDH12; DJ352A20.2
Locus ID 64577
UniProt ID Q9H2A2
Cytogenetics 6q23.3
Summary This gene encodes a member of the aldehyde dehydrogenase family of proteins. The encoded protein has been implicated in the synthesis of 9-cis-retinoic acid and in the breakdown of the amino acid tryptophan. This enzyme converts 9-cis-retinal into the retinoid X receptor ligand 9-cis-retinoic acid, and has approximately 40-fold higher activity with 9-cis-retinal than with all-trans-retinal. In addition, this enzyme has been shown to catalyze the conversion of 2-aminomuconic semialdehyde to 2-aminomuconate in the kynurenine pathway of tryptophan catabolism. [provided by RefSeq, Jul 2018]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ALDH8A1 (NM_022568) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406874 ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411634 ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434230 ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406874 Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 2 100 ug
$665.00
LY411634 Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 1 100 ug
$665.00
LY434230 Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 3 100 ug
$436.00
TP313029 Recombinant protein of human aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.