OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLA2G10 (NM_003561) Human Mass Spec Standard

Be the first to review this product
SKU
PH313014
PLA2G10 MS Standard C13 and N15-labeled recombinant protein (NP_003552)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418602 Transient overexpression lysate of phospholipase A2, group X (PLA2G10) (as WB positive control) 100 ug
$436.00

Other products for "PLA2G10 or NM_003561"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213014
Predicted MW 18.2 kDa
Protein Sequence
Protein Sequence
>RC213014 protein sequence
Red=Cloning site Green=Tags(s)

MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCG
LGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCL
AQTEYNLKYLFYPQFLCEPDSPKCD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003552
RefSeq Size 1020
RefSeq ORF 495
Synonyms GXPLA2; GXSPLA2; SPLA2; sPLA2-X
Locus ID 8399
UniProt ID O15496
Cytogenetics 16p13.12
Summary This gene encodes a member of the phospholipase A2 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This calcium-dependent enzyme hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids. In one example, this enzyme catalyzes the release of arachidonic acid from cell membrane phospholipids, thus playing a role in the production of various inflammatory lipid mediators, such as prostaglandins. The encoded protein may promote the survival of breast cancer cells through its role in lipid metabolism. provided by RefSeq, Nov 2015
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLA2G10" proteins (3)
SKU Description Size Price
LC418602 Lyophilized PLA2G10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418602 Transient overexpression lysate of phospholipase A2, group X (PLA2G10) (as WB positive control) 100 ug
$436.00
TP313014 Recombinant protein of human phospholipase A2, group X (PLA2G10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products